PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00033361001
Common NameGSBRNA2T00033361001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 334aa    MW: 36549.9 Da    PI: 6.7619
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00033361001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.42.9e-081958340
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40
                         +r C+ +++  +  fC+ ++ +lC +C + +H++  H++v
  GSBRNA2T00033361001 19 ARSCDACQSVSAAVFCRVDSAFLCLTCDTRIHSYtrHERV 58
                         578******99*********************87889876 PP

2zf-B_box26.81.1e-0859103442
             zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                            C+ +e+ ++   C+ +   lC +C + +H+       H++vp+
  GSBRNA2T00033361001  59 FLCEVCEQAPAAVTCKADAASLCVTCDSDIHSAnplasrHERVPV 103
                          68*****************************66999999999986 PP

3CCT70.15.5e-24265308144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  GSBRNA2T00033361001 265 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 308
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.5E-81760IPR000315B-box-type zinc finger
PROSITE profilePS501199.9261760IPR000315B-box-type zinc finger
PfamPF006431.4E-62058IPR000315B-box-type zinc finger
CDDcd000214.58E-82060No hitNo description
PROSITE profilePS5011910.66556103IPR000315B-box-type zinc finger
CDDcd000216.20E-859103No hitNo description
PfamPF006431.9E-659103IPR000315B-box-type zinc finger
SMARTSM003365.9E-1061103IPR000315B-box-type zinc finger
PROSITE profilePS5101716.817265307IPR010402CCT domain
PfamPF062035.0E-18265307IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGFGLENIKS ISGEWGAAAR SCDACQSVSA AVFCRVDSAF LCLTCDTRIH SYTRHERVFL  60
CEVCEQAPAA VTCKADAASL CVTCDSDIHS ANPLASRHER VPVESFFDSA ETAVAKISAS  120
TFGALGSSAT VDLTAVPVMG NSDELGLCPL LLPNDFSEPA KTEMKSSEFM FSDFDRLIDF  180
EYPNSFNHQQ PHNNAGADSL VPVQTKTEPL PLSKNDHCFD IDFCRSKLSA FTYPTQSISH  240
SVSTSTTTIT ASTATTGDQA SSMNREARVL RYREKRKNRK FEKTIRYASR KAYAESRPRI  300
KGRFAKRTET ENDNVFLSHV YASAAQYGVV PTF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00033361001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894790.0AC189479.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB081M20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612908.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH80.0COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A078GL610.0A0A078GL61_BRANA; BnaC09g32640D protein
STRINGAT5G57660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78992435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.10.0CONSTANS-like 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]